Sequence (fasta): 4ewxDownload

>4EWXA:Insulin A chain
GIVEQCCTSICSLYQLENYCN
>4EWXC:Insulin A chain
GIVEQCCTSICSLYQLENYCN
>4EWXB:Insulin B chain
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
>4EWXD:Insulin B chain
FVNQHLCGSHLVEALYLVCGERGFFYTPKT