Sequence (fasta): 4cyiDownload

>4CYIA:PAB-DEPENDENT POLY(A)-SPECIFIC RIBONUCLEASE SUBUNIT PAN3-LIKE PROTEIN, PAB-DEPENDENT POLY(A)-SPECIFIC RIBONUCLEASE SUBUNIT PAN3-L PROTEIN
GSRQELQPWQRATYDFFMPQNLREDLQKKQFATLQVIPNSGLPQLEHWHSLVPLDTSNRK
NTSCFGYPSWVYKAQNSRNGRHYALRRLEGYRLTNEKAILNVMKDWKKIKNASIVTIHEV
FTTREFGDSSLIFAYDFHPLSKTLQEHHFQPIHGNRYRPPPAVPENTIWGYICQIANALK
TIHSNRLAARCLEPSKIILTDINRIRLSACAILDVVQFGMNSRSVVELQQEDFVKFGKLI
LSLATGTLPAHLNNIPAALETLGNKYSANLKSAVNWLLDTSSGETKTIEHFMTGIASQMT
TFFDLALQDNDEKLFHLAREVENGRIARSLMKLLTILERGDYDGVPSWSETGDRYQLKLF
RDYVFHRVDADGKPNLSIGHMLTCMSKLEAGVDENILLTSRDNETVFVLSYRELRQMYDR
AFNELVKASKTGAPGANT
>4CYIB:PAB-DEPENDENT POLY(A)-SPECIFIC RIBONUCLEASE SUBUNIT PAN3-LIKE PROTEIN, PAB-DEPENDENT POLY(A)-SPECIFIC RIBONUCLEASE SUBUNIT PAN3-L PROTEIN
GSRQELQPWQRATYDFFMPQNLREDLQKKQFATLQVIPNSGLPQLEHWHSLVPLDTSNRK
NTSCFGYPSWVYKAQNSRNGRHYALRRLEGYRLTNEKAILNVMKDWKKIKNASIVTIHEV
FTTREFGDSSLIFAYDFHPLSKTLQEHHFQPIHGNRYRPPPAVPENTIWGYICQIANALK
TIHSNRLAARCLEPSKIILTDINRIRLSACAILDVVQFGMNSRSVVELQQEDFVKFGKLI
LSLATGTLPAHLNNIPAALETLGNKYSANLKSAVNWLLDTSSGETKTIEHFMTGIASQMT
TFFDLALQDNDEKLFHLAREVENGRIARSLMKLLTILERGDYDGVPSWSETGDRYQLKLF
RDYVFHRVDADGKPNLSIGHMLTCMSKLEAGVDENILLTSRDNETVFVLSYRELRQMYDR
AFNELVKASKTGAPGANT
>4CYIC:PAB-DEPENDENT POLY(A)-SPECIFIC RIBONUCLEASE SUBUNIT PAN3-LIKE PROTEIN, PAB-DEPENDENT POLY(A)-SPECIFIC RIBONUCLEASE SUBUNIT PAN3-L PROTEIN
GSRQELQPWQRATYDFFMPQNLREDLQKKQFATLQVIPNSGLPQLEHWHSLVPLDTSNRK
NTSCFGYPSWVYKAQNSRNGRHYALRRLEGYRLTNEKAILNVMKDWKKIKNASIVTIHEV
FTTREFGDSSLIFAYDFHPLSKTLQEHHFQPIHGNRYRPPPAVPENTIWGYICQIANALK
TIHSNRLAARCLEPSKIILTDINRIRLSACAILDVVQFGMNSRSVVELQQEDFVKFGKLI
LSLATGTLPAHLNNIPAALETLGNKYSANLKSAVNWLLDTSSGETKTIEHFMTGIASQMT
TFFDLALQDNDEKLFHLAREVENGRIARSLMKLLTILERGDYDGVPSWSETGDRYQLKLF
RDYVFHRVDADGKPNLSIGHMLTCMSKLEAGVDENILLTSRDNETVFVLSYRELRQMYDR
AFNELVKASKTGAPGANT
>4CYID:PAB-DEPENDENT POLY(A)-SPECIFIC RIBONUCLEASE SUBUNIT PAN3-LIKE PROTEIN, PAB-DEPENDENT POLY(A)-SPECIFIC RIBONUCLEASE SUBUNIT PAN3-L PROTEIN
GSRQELQPWQRATYDFFMPQNLREDLQKKQFATLQVIPNSGLPQLEHWHSLVPLDTSNRK
NTSCFGYPSWVYKAQNSRNGRHYALRRLEGYRLTNEKAILNVMKDWKKIKNASIVTIHEV
FTTREFGDSSLIFAYDFHPLSKTLQEHHFQPIHGNRYRPPPAVPENTIWGYICQIANALK
TIHSNRLAARCLEPSKIILTDINRIRLSACAILDVVQFGMNSRSVVELQQEDFVKFGKLI
LSLATGTLPAHLNNIPAALETLGNKYSANLKSAVNWLLDTSSGETKTIEHFMTGIASQMT
TFFDLALQDNDEKLFHLAREVENGRIARSLMKLLTILERGDYDGVPSWSETGDRYQLKLF
RDYVFHRVDADGKPNLSIGHMLTCMSKLEAGVDENILLTSRDNETVFVLSYRELRQMYDR
AFNELVKASKTGAPGANT
>4CYIE:PAB-DEPENDENT POLY(A)-SPECIFIC RIBONUCLEASE SUBUNIT PAN3-LIKE PROTEIN, PAB-DEPENDENT POLY(A)-SPECIFIC RIBONUCLEASE SUBUNIT PAN3-L PROTEIN
GSRQELQPWQRATYDFFMPQNLREDLQKKQFATLQVIPNSGLPQLEHWHSLVPLDTSNRK
NTSCFGYPSWVYKAQNSRNGRHYALRRLEGYRLTNEKAILNVMKDWKKIKNASIVTIHEV
FTTREFGDSSLIFAYDFHPLSKTLQEHHFQPIHGNRYRPPPAVPENTIWGYICQIANALK
TIHSNRLAARCLEPSKIILTDINRIRLSACAILDVVQFGMNSRSVVELQQEDFVKFGKLI
LSLATGTLPAHLNNIPAALETLGNKYSANLKSAVNWLLDTSSGETKTIEHFMTGIASQMT
TFFDLALQDNDEKLFHLAREVENGRIARSLMKLLTILERGDYDGVPSWSETGDRYQLKLF
RDYVFHRVDADGKPNLSIGHMLTCMSKLEAGVDENILLTSRDNETVFVLSYRELRQMYDR
AFNELVKASKTGAPGANT
>4CYIF:PAB-DEPENDENT POLY(A)-SPECIFIC RIBONUCLEASE SUBUNIT PAN3-LIKE PROTEIN, PAB-DEPENDENT POLY(A)-SPECIFIC RIBONUCLEASE SUBUNIT PAN3-L PROTEIN
GSRQELQPWQRATYDFFMPQNLREDLQKKQFATLQVIPNSGLPQLEHWHSLVPLDTSNRK
NTSCFGYPSWVYKAQNSRNGRHYALRRLEGYRLTNEKAILNVMKDWKKIKNASIVTIHEV
FTTREFGDSSLIFAYDFHPLSKTLQEHHFQPIHGNRYRPPPAVPENTIWGYICQIANALK
TIHSNRLAARCLEPSKIILTDINRIRLSACAILDVVQFGMNSRSVVELQQEDFVKFGKLI
LSLATGTLPAHLNNIPAALETLGNKYSANLKSAVNWLLDTSSGETKTIEHFMTGIASQMT
TFFDLALQDNDEKLFHLAREVENGRIARSLMKLLTILERGDYDGVPSWSETGDRYQLKLF
RDYVFHRVDADGKPNLSIGHMLTCMSKLEAGVDENILLTSRDNETVFVLSYRELRQMYDR
AFNELVKASKTGAPGANT
>4CYIG:PAB-DEPENDENT POLY(A)-SPECIFIC RIBONUCLEASE SUBUNIT PAN3-LIKE PROTEIN, PAB-DEPENDENT POLY(A)-SPECIFIC RIBONUCLEASE SUBUNIT PAN3-L PROTEIN
GSRQELQPWQRATYDFFMPQNLREDLQKKQFATLQVIPNSGLPQLEHWHSLVPLDTSNRK
NTSCFGYPSWVYKAQNSRNGRHYALRRLEGYRLTNEKAILNVMKDWKKIKNASIVTIHEV
FTTREFGDSSLIFAYDFHPLSKTLQEHHFQPIHGNRYRPPPAVPENTIWGYICQIANALK
TIHSNRLAARCLEPSKIILTDINRIRLSACAILDVVQFGMNSRSVVELQQEDFVKFGKLI
LSLATGTLPAHLNNIPAALETLGNKYSANLKSAVNWLLDTSSGETKTIEHFMTGIASQMT
TFFDLALQDNDEKLFHLAREVENGRIARSLMKLLTILERGDYDGVPSWSETGDRYQLKLF
RDYVFHRVDADGKPNLSIGHMLTCMSKLEAGVDENILLTSRDNETVFVLSYRELRQMYDR
AFNELVKASKTGAPGANT
>4CYIH:PAB-DEPENDENT POLY(A)-SPECIFIC RIBONUCLEASE SUBUNIT PAN3-LIKE PROTEIN, PAB-DEPENDENT POLY(A)-SPECIFIC RIBONUCLEASE SUBUNIT PAN3-L PROTEIN
GSRQELQPWQRATYDFFMPQNLREDLQKKQFATLQVIPNSGLPQLEHWHSLVPLDTSNRK
NTSCFGYPSWVYKAQNSRNGRHYALRRLEGYRLTNEKAILNVMKDWKKIKNASIVTIHEV
FTTREFGDSSLIFAYDFHPLSKTLQEHHFQPIHGNRYRPPPAVPENTIWGYICQIANALK
TIHSNRLAARCLEPSKIILTDINRIRLSACAILDVVQFGMNSRSVVELQQEDFVKFGKLI
LSLATGTLPAHLNNIPAALETLGNKYSANLKSAVNWLLDTSSGETKTIEHFMTGIASQMT
TFFDLALQDNDEKLFHLAREVENGRIARSLMKLLTILERGDYDGVPSWSETGDRYQLKLF
RDYVFHRVDADGKPNLSIGHMLTCMSKLEAGVDENILLTSRDNETVFVLSYRELRQMYDR
AFNELVKASKTGAPGANT