Sequence (fasta): 4cdeDownload

>4CDEA:DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN
DTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHF
TIIYNQGFEIVLNDYKWFAFFKYKEEGSKVTTYCNETMTGWVHDVLGRNWACFTGKKVG
>4CDED:DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN
DTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHF
TIIYNQGFEIVLNDYKWFAFFKYKEEGSKVTTYCNETMTGWVHDVLGRNWACFTGKKVG
>4CDEB:DIPEPTIDYL PEPTIDASE 1 HEAVY CHAIN
HLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVV
SCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVG
GFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHTGLR
>4CDEE:DIPEPTIDYL PEPTIDASE 1 HEAVY CHAIN
HLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVV
SCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVG
GFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHTGLR
>4CDEC:DIPEPTIDYL PEPTIDASE 1 LIGHT CHAIN
DPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIA
VAATPIPKL
>4CDEF:DIPEPTIDYL PEPTIDASE 1 LIGHT CHAIN
DPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIA
VAATPIPKL