Sequence (fasta): 3ze4Download

>3ZE4A:DIACYLGLYCEROL KINASE
GHHHHHHELANNTTGFTRIIKAAGYSWKGLRAAWINEAAFRQEGVAVLLAVVIACWLDVD
AITRVLLISSVMLVMIVEILNSAIEAVVDRIGSEYHELSGRAKDMGSAAVLIAIIVAVIT
WCILLWSHFG
>3ZE4B:DIACYLGLYCEROL KINASE
GHHHHHHELANNTTGFTRIIKAAGYSWKGLRAAWINEAAFRQEGVAVLLAVVIACWLDVD
AITRVLLISSVMLVMIVEILNSAIEAVVDRIGSEYHELSGRAKDMGSAAVLIAIIVAVIT
WCILLWSHFG
>3ZE4C:DIACYLGLYCEROL KINASE
GHHHHHHELANNTTGFTRIIKAAGYSWKGLRAAWINEAAFRQEGVAVLLAVVIACWLDVD
AITRVLLISSVMLVMIVEILNSAIEAVVDRIGSEYHELSGRAKDMGSAAVLIAIIVAVIT
WCILLWSHFG