Sequence (fasta): 3umiDownload

>3UMIA:Amyloid beta A4 protein
MSTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADK
KAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPR
HVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLL
YNVPAVAEEIQDEVDELLQKEQNYSDDIEGR