Sequence (fasta): 3tm4Download

>3TM4A:tRNA (guanine N2-)-methyltransferase Trm14
MKFLLTTAQGIEDIAKREVSLLLKKLGISFQIEEKPLGIEGRLLLEAEKAYYVDEKGRKR
ELSISTYLNENSRLLHRVIIEIASEKFNGIEKDESEEALKRIKDFVSSLPVEQFVKVSET
FAVRSFRKGDHNITSIDIARTVGEAIFERLSRFGTPLVNLDHPAVIFRAELIKDVFFLGI
DTTGDSSLHKRPWRVYDHPAHLKASIANAMIELAELDGGSVLDPMCGSGTILIELALRRY
SGEIIGIEKYRKHLIGAEMNALAAGVLDKIKFIQGDATQLSQYVDSVDFAISNLPYGLKI
GKKSMIPDLYMKFFNELAKVLEKRGVFITTEKKAIEEAIAENGFEIIHHRVIGHGGLMVH
LYVVKLEHHHHHH
>3TM4B:tRNA (guanine N2-)-methyltransferase Trm14
MKFLLTTAQGIEDIAKREVSLLLKKLGISFQIEEKPLGIEGRLLLEAEKAYYVDEKGRKR
ELSISTYLNENSRLLHRVIIEIASEKFNGIEKDESEEALKRIKDFVSSLPVEQFVKVSET
FAVRSFRKGDHNITSIDIARTVGEAIFERLSRFGTPLVNLDHPAVIFRAELIKDVFFLGI
DTTGDSSLHKRPWRVYDHPAHLKASIANAMIELAELDGGSVLDPMCGSGTILIELALRRY
SGEIIGIEKYRKHLIGAEMNALAAGVLDKIKFIQGDATQLSQYVDSVDFAISNLPYGLKI
GKKSMIPDLYMKFFNELAKVLEKRGVFITTEKKAIEEAIAENGFEIIHHRVIGHGGLMVH
LYVVKLEHHHHHH