Sequence (fasta): 3qrfDownload

>3QRFN:Nuclear factor of activated T-cells, cytoplasmic 2
SSVPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENK
PLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRAT
IDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQR
SAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVAAAA
AAPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPV
>3QRFM:Nuclear factor of activated T-cells, cytoplasmic 2
SSVPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENK
PLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRAT
IDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQR
SAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVAAAA
AAPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPV
>3QRFF:Forkhead box protein P3
MRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCF
VRVESEKGAVWTVDELEFRKKR
>3QRFG:Forkhead box protein P3
MRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCF
VRVESEKGAVWTVDELEFRKKR
>3QRFH:Forkhead box protein P3
MRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCF
VRVESEKGAVWTVDELEFRKKR
>3QRFI:Forkhead box protein P3
MRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCF
VRVESEKGAVWTVDELEFRKKR
>3QRFC:human hARRE2 DNA (Plus Strand)
TTAGGAAAATTTGTTTCATAG
>3QRFA:human hARRE2 DNA (Plus Strand)
TTAGGAAAATTTGTTTCATAG
>3QRFD:human hARRE2 DNA (Minus Strand)
AACTATGAAACAAATTTTCCT
>3QRFB:human hARRE2 DNA (Minus Strand)
AACTATGAAACAAATTTTCCT