Sequence (fasta): 3pvyDownload

>3PVYA:Phenylacetic acid degradation protein paaA
MRSTQEERFEQRIAQETAIEPQDWMPDAYRKTLIRQIGQHAHSEIVGMLPEGNWITRAPT
LRRKAILLAKVQDEAGHGLYLYSAAETLGCAREDIYQKMLDGRMKYSSIFNYPTLSWADI
GVIGWLVDGAAIVNQVALCRTSYGPYARAMVKICKEESFHQRQGFEACMALAQGSEAQKQ
MLQDAINRFWWPALMMFGPNDDNSPNSARSLTWKIKRFTNDELRQRFVDNTVPQVEMLGM
TVPDPDLHFDTESGHYRFGEIDWQEFNEVINGRGICNQERLDAKRKAWEEGTWVREAALA
HAQKQHARKVA
>3PVYB:Phenylacetic acid degradation protein paaC
MGSSHHHHHHGSNQLTAYTLRLGDNCLVLSQRLGEWCGHAPELEIDLALANIGLDLLGQA
RNFLSYAAELAGEGDEDTLAFTRDERQFSNLLLVEQPNGNFADTIARQYFIDAWHVALFT
RLMESRDPQLAAISAKAIKEARYHLRFSRGWLERLGNGTDVSGQKMQQAINKLWRFTAEL
FDADEIDIALSEEGIAVDPRTLRAAWEAEVFAGINEATLNVPQEQAYRTGGKKGLHTEHL
GPMLAEMQYLQRVLPGQQW
>3PVYC:Phenylacetic acid degradation protein paaC
MGSSHHHHHHGSNQLTAYTLRLGDNCLVLSQRLGEWCGHAPELEIDLALANIGLDLLGQA
RNFLSYAAELAGEGDEDTLAFTRDERQFSNLLLVEQPNGNFADTIARQYFIDAWHVALFT
RLMESRDPQLAAISAKAIKEARYHLRFSRGWLERLGNGTDVSGQKMQQAINKLWRFTAEL
FDADEIDIALSEEGIAVDPRTLRAAWEAEVFAGINEATLNVPQEQAYRTGGKKGLHTEHL
GPMLAEMQYLQRVLPGQQW