Sequence (fasta): 3p33Download

>3P33A:Insulin
GIVEQCCTSICSLYQLENYCN
>3P33C:Insulin
GIVEQCCTSICSLYQLENYCN
>3P33E:Insulin
GIVEQCCTSICSLYQLENYCN
>3P33G:Insulin
GIVEQCCTSICSLYQLENYCN
>3P33B:Insulin
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
>3P33D:Insulin
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
>3P33F:Insulin
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
>3P33H:Insulin
FVNQHLCGSHLVEALYLVCGERGFFYTPKT