Sequence (fasta): 3kkyDownload

>3KKYA:Superoxide dismutase [Mn]
MAYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQL
DRVPADKKGALRNNAGGHANHSMFWQIMGQGQGQNGANQPSGELLDAINSAFGSFDAFKQ
KFEDAAKTRFGSGWAWLVVKDGKLDVVSTANQDNPLMGEAIAGVSGTPILGVDVWEHAYY
LNYQNRRPDYLAAFWNVVNWDEVSKRYAAAK
>3KKYB:Superoxide dismutase [Mn]
MAYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQL
DRVPADKKGALRNNAGGHANHSMFWQIMGQGQGQNGANQPSGELLDAINSAFGSFDAFKQ
KFEDAAKTRFGSGWAWLVVKDGKLDVVSTANQDNPLMGEAIAGVSGTPILGVDVWEHAYY
LNYQNRRPDYLAAFWNVVNWDEVSKRYAAAK