Sequence (fasta): 3h0mDownload

>3H0MA:Glutamyl-tRNA(Gln) amidotransferase subunit A
MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVKAYITPLYGKALKQAESLKER
ELPLFGIPIAVKDNILVEGEKTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSAPVSLGSDTGGSIRQPASFCG
VIGIKPTYGRVSRYGLVAFASSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKELEKEGFEIKEVSLPHVKYSIP
TYYIIAPSEASSNLARYDGVRYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTLPFKFGERLENPIEMYLSDIL
TVPANLAGLPAISIPIAWKDGLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
>3H0MD:Glutamyl-tRNA(Gln) amidotransferase subunit A
MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVKAYITPLYGKALKQAESLKER
ELPLFGIPIAVKDNILVEGEKTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSAPVSLGSDTGGSIRQPASFCG
VIGIKPTYGRVSRYGLVAFASSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKELEKEGFEIKEVSLPHVKYSIP
TYYIIAPSEASSNLARYDGVRYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTLPFKFGERLENPIEMYLSDIL
TVPANLAGLPAISIPIAWKDGLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
>3H0MG:Glutamyl-tRNA(Gln) amidotransferase subunit A
MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVKAYITPLYGKALKQAESLKER
ELPLFGIPIAVKDNILVEGEKTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSAPVSLGSDTGGSIRQPASFCG
VIGIKPTYGRVSRYGLVAFASSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKELEKEGFEIKEVSLPHVKYSIP
TYYIIAPSEASSNLARYDGVRYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTLPFKFGERLENPIEMYLSDIL
TVPANLAGLPAISIPIAWKDGLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
>3H0MJ:Glutamyl-tRNA(Gln) amidotransferase subunit A
MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVKAYITPLYGKALKQAESLKER
ELPLFGIPIAVKDNILVEGEKTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSAPVSLGSDTGGSIRQPASFCG
VIGIKPTYGRVSRYGLVAFASSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKELEKEGFEIKEVSLPHVKYSIP
TYYIIAPSEASSNLARYDGVRYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTLPFKFGERLENPIEMYLSDIL
TVPANLAGLPAISIPIAWKDGLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
>3H0MM:Glutamyl-tRNA(Gln) amidotransferase subunit A
MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVKAYITPLYGKALKQAESLKER
ELPLFGIPIAVKDNILVEGEKTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSAPVSLGSDTGGSIRQPASFCG
VIGIKPTYGRVSRYGLVAFASSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKELEKEGFEIKEVSLPHVKYSIP
TYYIIAPSEASSNLARYDGVRYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTLPFKFGERLENPIEMYLSDIL
TVPANLAGLPAISIPIAWKDGLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
>3H0MP:Glutamyl-tRNA(Gln) amidotransferase subunit A
MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVKAYITPLYGKALKQAESLKER
ELPLFGIPIAVKDNILVEGEKTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSAPVSLGSDTGGSIRQPASFCG
VIGIKPTYGRVSRYGLVAFASSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKELEKEGFEIKEVSLPHVKYSIP
TYYIIAPSEASSNLARYDGVRYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTLPFKFGERLENPIEMYLSDIL
TVPANLAGLPAISIPIAWKDGLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
>3H0MS:Glutamyl-tRNA(Gln) amidotransferase subunit A
MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVKAYITPLYGKALKQAESLKER
ELPLFGIPIAVKDNILVEGEKTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSAPVSLGSDTGGSIRQPASFCG
VIGIKPTYGRVSRYGLVAFASSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKELEKEGFEIKEVSLPHVKYSIP
TYYIIAPSEASSNLARYDGVRYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTLPFKFGERLENPIEMYLSDIL
TVPANLAGLPAISIPIAWKDGLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
>3H0MV:Glutamyl-tRNA(Gln) amidotransferase subunit A
MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVKAYITPLYGKALKQAESLKER
ELPLFGIPIAVKDNILVEGEKTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSAPVSLGSDTGGSIRQPASFCG
VIGIKPTYGRVSRYGLVAFASSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKELEKEGFEIKEVSLPHVKYSIP
TYYIIAPSEASSNLARYDGVRYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTLPFKFGERLENPIEMYLSDIL
TVPANLAGLPAISIPIAWKDGLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
>3H0MB:Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
MNEKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPVCLGMPGALPIVNKRAVEY
AIRASLALNCEVHEESVFARKHYFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVR
IRRLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRTPEEARLFLEKLRNIMRYA
GVSKADMEKGQLRCDINVSIRPKGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEE
GGEVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLKVKKEWIEEIKKNMPELPD
QRFERLIKEYGLSEYEAGILVNHKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGI
SIEESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKTPSQIVEEKGLKQITDENQ
IKELVKKIFEKHPKEVERLKQGEEKLIGFFVGQVMRETRGKANPQVVNKVIRELVKEV
>3H0ME:Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
MNEKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPVCLGMPGALPIVNKRAVEY
AIRASLALNCEVHEESVFARKHYFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVR
IRRLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRTPEEARLFLEKLRNIMRYA
GVSKADMEKGQLRCDINVSIRPKGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEE
GGEVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLKVKKEWIEEIKKNMPELPD
QRFERLIKEYGLSEYEAGILVNHKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGI
SIEESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKTPSQIVEEKGLKQITDENQ
IKELVKKIFEKHPKEVERLKQGEEKLIGFFVGQVMRETRGKANPQVVNKVIRELVKEV
>3H0MH:Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
MNEKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPVCLGMPGALPIVNKRAVEY
AIRASLALNCEVHEESVFARKHYFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVR
IRRLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRTPEEARLFLEKLRNIMRYA
GVSKADMEKGQLRCDINVSIRPKGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEE
GGEVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLKVKKEWIEEIKKNMPELPD
QRFERLIKEYGLSEYEAGILVNHKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGI
SIEESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKTPSQIVEEKGLKQITDENQ
IKELVKKIFEKHPKEVERLKQGEEKLIGFFVGQVMRETRGKANPQVVNKVIRELVKEV
>3H0MK:Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
MNEKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPVCLGMPGALPIVNKRAVEY
AIRASLALNCEVHEESVFARKHYFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVR
IRRLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRTPEEARLFLEKLRNIMRYA
GVSKADMEKGQLRCDINVSIRPKGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEE
GGEVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLKVKKEWIEEIKKNMPELPD
QRFERLIKEYGLSEYEAGILVNHKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGI
SIEESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKTPSQIVEEKGLKQITDENQ
IKELVKKIFEKHPKEVERLKQGEEKLIGFFVGQVMRETRGKANPQVVNKVIRELVKEV
>3H0MN:Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
MNEKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPVCLGMPGALPIVNKRAVEY
AIRASLALNCEVHEESVFARKHYFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVR
IRRLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRTPEEARLFLEKLRNIMRYA
GVSKADMEKGQLRCDINVSIRPKGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEE
GGEVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLKVKKEWIEEIKKNMPELPD
QRFERLIKEYGLSEYEAGILVNHKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGI
SIEESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKTPSQIVEEKGLKQITDENQ
IKELVKKIFEKHPKEVERLKQGEEKLIGFFVGQVMRETRGKANPQVVNKVIRELVKEV
>3H0MQ:Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
MNEKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPVCLGMPGALPIVNKRAVEY
AIRASLALNCEVHEESVFARKHYFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVR
IRRLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRTPEEARLFLEKLRNIMRYA
GVSKADMEKGQLRCDINVSIRPKGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEE
GGEVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLKVKKEWIEEIKKNMPELPD
QRFERLIKEYGLSEYEAGILVNHKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGI
SIEESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKTPSQIVEEKGLKQITDENQ
IKELVKKIFEKHPKEVERLKQGEEKLIGFFVGQVMRETRGKANPQVVNKVIRELVKEV
>3H0MT:Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
MNEKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPVCLGMPGALPIVNKRAVEY
AIRASLALNCEVHEESVFARKHYFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVR
IRRLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRTPEEARLFLEKLRNIMRYA
GVSKADMEKGQLRCDINVSIRPKGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEE
GGEVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLKVKKEWIEEIKKNMPELPD
QRFERLIKEYGLSEYEAGILVNHKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGI
SIEESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKTPSQIVEEKGLKQITDENQ
IKELVKKIFEKHPKEVERLKQGEEKLIGFFVGQVMRETRGKANPQVVNKVIRELVKEV
>3H0MW:Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
MNEKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPVCLGMPGALPIVNKRAVEY
AIRASLALNCEVHEESVFARKHYFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVR
IRRLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRTPEEARLFLEKLRNIMRYA
GVSKADMEKGQLRCDINVSIRPKGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEE
GGEVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLKVKKEWIEEIKKNMPELPD
QRFERLIKEYGLSEYEAGILVNHKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGI
SIEESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKTPSQIVEEKGLKQITDENQ
IKELVKKIFEKHPKEVERLKQGEEKLIGFFVGQVMRETRGKANPQVVNKVIRELVKEV
>3H0MC:Glutamyl-tRNA(Gln) amidotransferase subunit C
MVDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLKELDTENVEPYIQEFEETPM
REDEPHPSLDREKALMNAPERKDGFFVVPRVVEV
>3H0MF:Glutamyl-tRNA(Gln) amidotransferase subunit C
MVDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLKELDTENVEPYIQEFEETPM
REDEPHPSLDREKALMNAPERKDGFFVVPRVVEV
>3H0MI:Glutamyl-tRNA(Gln) amidotransferase subunit C
MVDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLKELDTENVEPYIQEFEETPM
REDEPHPSLDREKALMNAPERKDGFFVVPRVVEV
>3H0ML:Glutamyl-tRNA(Gln) amidotransferase subunit C
MVDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLKELDTENVEPYIQEFEETPM
REDEPHPSLDREKALMNAPERKDGFFVVPRVVEV
>3H0MO:Glutamyl-tRNA(Gln) amidotransferase subunit C
MVDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLKELDTENVEPYIQEFEETPM
REDEPHPSLDREKALMNAPERKDGFFVVPRVVEV
>3H0MR:Glutamyl-tRNA(Gln) amidotransferase subunit C
MVDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLKELDTENVEPYIQEFEETPM
REDEPHPSLDREKALMNAPERKDGFFVVPRVVEV
>3H0MU:Glutamyl-tRNA(Gln) amidotransferase subunit C
MVDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLKELDTENVEPYIQEFEETPM
REDEPHPSLDREKALMNAPERKDGFFVVPRVVEV
>3H0MX:Glutamyl-tRNA(Gln) amidotransferase subunit C
MVDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLKELDTENVEPYIQEFEETPM
REDEPHPSLDREKALMNAPERKDGFFVVPRVVEV