Sequence (fasta): 3h0lDownload

>3H0LA:Glutamyl-tRNA(Gln) amidotransferase subunit A
MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVKAYITPLYGKALKQAESLKER
ELPLFGIPIAVKDNILVEGEKTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSAPVSLGSDTGGSIRQPASFCG
VIGIKPTYGRVSRYGLVAFASSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKELEKEGFEIKEVSLPHVKYSIP
TYYIIAPSEASSNLARYDGVRYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTLPFKFGERLENPIEMYLSDIL
TVPANLAGLPAISIPIAWKDGLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
>3H0LD:Glutamyl-tRNA(Gln) amidotransferase subunit A
MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVKAYITPLYGKALKQAESLKER
ELPLFGIPIAVKDNILVEGEKTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSAPVSLGSDTGGSIRQPASFCG
VIGIKPTYGRVSRYGLVAFASSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKELEKEGFEIKEVSLPHVKYSIP
TYYIIAPSEASSNLARYDGVRYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTLPFKFGERLENPIEMYLSDIL
TVPANLAGLPAISIPIAWKDGLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
>3H0LG:Glutamyl-tRNA(Gln) amidotransferase subunit A
MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVKAYITPLYGKALKQAESLKER
ELPLFGIPIAVKDNILVEGEKTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSAPVSLGSDTGGSIRQPASFCG
VIGIKPTYGRVSRYGLVAFASSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKELEKEGFEIKEVSLPHVKYSIP
TYYIIAPSEASSNLARYDGVRYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTLPFKFGERLENPIEMYLSDIL
TVPANLAGLPAISIPIAWKDGLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
>3H0LJ:Glutamyl-tRNA(Gln) amidotransferase subunit A
MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVKAYITPLYGKALKQAESLKER
ELPLFGIPIAVKDNILVEGEKTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSAPVSLGSDTGGSIRQPASFCG
VIGIKPTYGRVSRYGLVAFASSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKELEKEGFEIKEVSLPHVKYSIP
TYYIIAPSEASSNLARYDGVRYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTLPFKFGERLENPIEMYLSDIL
TVPANLAGLPAISIPIAWKDGLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
>3H0LM:Glutamyl-tRNA(Gln) amidotransferase subunit A
MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVKAYITPLYGKALKQAESLKER
ELPLFGIPIAVKDNILVEGEKTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSAPVSLGSDTGGSIRQPASFCG
VIGIKPTYGRVSRYGLVAFASSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKELEKEGFEIKEVSLPHVKYSIP
TYYIIAPSEASSNLARYDGVRYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTLPFKFGERLENPIEMYLSDIL
TVPANLAGLPAISIPIAWKDGLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
>3H0LP:Glutamyl-tRNA(Gln) amidotransferase subunit A
MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVKAYITPLYGKALKQAESLKER
ELPLFGIPIAVKDNILVEGEKTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSAPVSLGSDTGGSIRQPASFCG
VIGIKPTYGRVSRYGLVAFASSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKELEKEGFEIKEVSLPHVKYSIP
TYYIIAPSEASSNLARYDGVRYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTLPFKFGERLENPIEMYLSDIL
TVPANLAGLPAISIPIAWKDGLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
>3H0LS:Glutamyl-tRNA(Gln) amidotransferase subunit A
MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVKAYITPLYGKALKQAESLKER
ELPLFGIPIAVKDNILVEGEKTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSAPVSLGSDTGGSIRQPASFCG
VIGIKPTYGRVSRYGLVAFASSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKELEKEGFEIKEVSLPHVKYSIP
TYYIIAPSEASSNLARYDGVRYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTLPFKFGERLENPIEMYLSDIL
TVPANLAGLPAISIPIAWKDGLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
>3H0LV:Glutamyl-tRNA(Gln) amidotransferase subunit A
MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVKAYITPLYGKALKQAESLKER
ELPLFGIPIAVKDNILVEGEKTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSAPVSLGSDTGGSIRQPASFCG
VIGIKPTYGRVSRYGLVAFASSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKELEKEGFEIKEVSLPHVKYSIP
TYYIIAPSEASSNLARYDGVRYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTLPFKFGERLENPIEMYLSDIL
TVPANLAGLPAISIPIAWKDGLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
>3H0LB:Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
MNEKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPVCLGMPGALPIVNKRAVEY
AIRASLALNCEVHEESVFARKHYFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVR
IRRLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRTPEEARLFLEKLRNIMRYA
GVSKADMEKGQLRCDINVSIRPKGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEE
GGEVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLKVKKEWIEEIKKNMPELPD
QRFERLIKEYGLSEYEAGILVNHKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGI
SIEESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKTPSQIVEEKGLKQITDENQ
IKELVKKIFEKHPKEVERLKQGEEKLIGFFVGQVMRETRGKANPQVVNKVIRELVKEV
>3H0LE:Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
MNEKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPVCLGMPGALPIVNKRAVEY
AIRASLALNCEVHEESVFARKHYFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVR
IRRLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRTPEEARLFLEKLRNIMRYA
GVSKADMEKGQLRCDINVSIRPKGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEE
GGEVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLKVKKEWIEEIKKNMPELPD
QRFERLIKEYGLSEYEAGILVNHKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGI
SIEESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKTPSQIVEEKGLKQITDENQ
IKELVKKIFEKHPKEVERLKQGEEKLIGFFVGQVMRETRGKANPQVVNKVIRELVKEV
>3H0LH:Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
MNEKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPVCLGMPGALPIVNKRAVEY
AIRASLALNCEVHEESVFARKHYFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVR
IRRLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRTPEEARLFLEKLRNIMRYA
GVSKADMEKGQLRCDINVSIRPKGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEE
GGEVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLKVKKEWIEEIKKNMPELPD
QRFERLIKEYGLSEYEAGILVNHKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGI
SIEESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKTPSQIVEEKGLKQITDENQ
IKELVKKIFEKHPKEVERLKQGEEKLIGFFVGQVMRETRGKANPQVVNKVIRELVKEV
>3H0LK:Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
MNEKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPVCLGMPGALPIVNKRAVEY
AIRASLALNCEVHEESVFARKHYFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVR
IRRLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRTPEEARLFLEKLRNIMRYA
GVSKADMEKGQLRCDINVSIRPKGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEE
GGEVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLKVKKEWIEEIKKNMPELPD
QRFERLIKEYGLSEYEAGILVNHKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGI
SIEESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKTPSQIVEEKGLKQITDENQ
IKELVKKIFEKHPKEVERLKQGEEKLIGFFVGQVMRETRGKANPQVVNKVIRELVKEV
>3H0LN:Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
MNEKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPVCLGMPGALPIVNKRAVEY
AIRASLALNCEVHEESVFARKHYFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVR
IRRLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRTPEEARLFLEKLRNIMRYA
GVSKADMEKGQLRCDINVSIRPKGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEE
GGEVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLKVKKEWIEEIKKNMPELPD
QRFERLIKEYGLSEYEAGILVNHKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGI
SIEESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKTPSQIVEEKGLKQITDENQ
IKELVKKIFEKHPKEVERLKQGEEKLIGFFVGQVMRETRGKANPQVVNKVIRELVKEV
>3H0LQ:Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
MNEKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPVCLGMPGALPIVNKRAVEY
AIRASLALNCEVHEESVFARKHYFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVR
IRRLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRTPEEARLFLEKLRNIMRYA
GVSKADMEKGQLRCDINVSIRPKGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEE
GGEVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLKVKKEWIEEIKKNMPELPD
QRFERLIKEYGLSEYEAGILVNHKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGI
SIEESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKTPSQIVEEKGLKQITDENQ
IKELVKKIFEKHPKEVERLKQGEEKLIGFFVGQVMRETRGKANPQVVNKVIRELVKEV
>3H0LT:Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
MNEKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPVCLGMPGALPIVNKRAVEY
AIRASLALNCEVHEESVFARKHYFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVR
IRRLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRTPEEARLFLEKLRNIMRYA
GVSKADMEKGQLRCDINVSIRPKGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEE
GGEVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLKVKKEWIEEIKKNMPELPD
QRFERLIKEYGLSEYEAGILVNHKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGI
SIEESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKTPSQIVEEKGLKQITDENQ
IKELVKKIFEKHPKEVERLKQGEEKLIGFFVGQVMRETRGKANPQVVNKVIRELVKEV
>3H0LW:Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
MNEKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPVCLGMPGALPIVNKRAVEY
AIRASLALNCEVHEESVFARKHYFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVR
IRRLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRTPEEARLFLEKLRNIMRYA
GVSKADMEKGQLRCDINVSIRPKGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEE
GGEVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLKVKKEWIEEIKKNMPELPD
QRFERLIKEYGLSEYEAGILVNHKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGI
SIEESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKTPSQIVEEKGLKQITDENQ
IKELVKKIFEKHPKEVERLKQGEEKLIGFFVGQVMRETRGKANPQVVNKVIRELVKEV
>3H0LC:Glutamyl-tRNA(Gln) amidotransferase subunit C
MVDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLKELDTENVEPYIQEFEETPM
REDEPHPSLDREKALMNAPERKDGFFVVPRVVEV
>3H0LF:Glutamyl-tRNA(Gln) amidotransferase subunit C
MVDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLKELDTENVEPYIQEFEETPM
REDEPHPSLDREKALMNAPERKDGFFVVPRVVEV
>3H0LI:Glutamyl-tRNA(Gln) amidotransferase subunit C
MVDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLKELDTENVEPYIQEFEETPM
REDEPHPSLDREKALMNAPERKDGFFVVPRVVEV
>3H0LL:Glutamyl-tRNA(Gln) amidotransferase subunit C
MVDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLKELDTENVEPYIQEFEETPM
REDEPHPSLDREKALMNAPERKDGFFVVPRVVEV
>3H0LO:Glutamyl-tRNA(Gln) amidotransferase subunit C
MVDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLKELDTENVEPYIQEFEETPM
REDEPHPSLDREKALMNAPERKDGFFVVPRVVEV
>3H0LR:Glutamyl-tRNA(Gln) amidotransferase subunit C
MVDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLKELDTENVEPYIQEFEETPM
REDEPHPSLDREKALMNAPERKDGFFVVPRVVEV
>3H0LU:Glutamyl-tRNA(Gln) amidotransferase subunit C
MVDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLKELDTENVEPYIQEFEETPM
REDEPHPSLDREKALMNAPERKDGFFVVPRVVEV
>3H0LX:Glutamyl-tRNA(Gln) amidotransferase subunit C
MVDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLKELDTENVEPYIQEFEETPM
REDEPHPSLDREKALMNAPERKDGFFVVPRVVEV