Sequence (fasta): 3go5Download

>3GO5A:Multidomain protein with S1 RNA-binding domains
GMNTNLASFIVGLIIDENDRFYFVQKDGQTYALAKEEGQHTVGDTVKGFAYTDMKQKLRL
TTLEVTATQDQFGWGRVTEVRKDLGVFVDTGLPDKEIVVSLDILPELKELWPKKGDQLYI
RLEVDKKDRIWGLLAYQEDFQRLARPAYNNMQNQNWPAIVYRLKLSGTFVYLPENNMLGF
IHPSERYAEPRLGQVLDARVIGFREVDRTLNLSLKPRSFEMLENDAQMILTYLESNGGFM
TLNDKSSPDDIKATFGISKGQFKKALGGLMKAGKIKQDQFGTELI