Sequence (fasta): 3g46Download

>3G46A:Globin-1
PSVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQG
MANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKK
VLASKNFGDKYANAWAKLVAVVQAAL
>3G46B:Globin-1
PSVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQG
MANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKK
VLASKNFGDKYANAWAKLVAVVQAAL