Sequence (fasta): 2zxqDownload

>2ZXQA:Endo-alpha-N-acetylgalactosaminidase
MGSSHHHHHHSSGLVPRGSHMVASETLKTKKMEVQIKKNFPSVLQYTMTDGKVMYGQSKD
VRTVEINGTNIELGDDDVTFKKVSDTEATYTLKVKDEAKKIDAVITVQITVKANQLHLNV
TKIKNNLSEGIPEGNGVEENAIQTLSFPNQSLVSVRSSQENAQFTGARMSSNTQKPGDTN
FAVTEDTNVTDSDYTYGFISGAGLSAGLWSNSEHDGTYVAAPVRGGSQNTRVYATTQQTG
DATSLGLASAPWYYHRTVTDSKGKKYTVAETALPQMAVAIAGDENEDGAVNWQDGAIAYR
DIMNNPYKSEEVPELVAWRIAMNFGSQAQNPFLTTLDNVKKVALNTDGLGQSVLLKGYGN
EGHDSGHPDYGDIGQRLGGADDMNTMMEEGSKYGARFGVHVNASEMYPEAKAFSEDMVRR
NSAGGLSYGWNWLDQGVGIDGIYDLASGSRVSRFADLSKEVGDNMDFIYLDVWGNLTSSG
SEDSWETRKMSKMINDNGWRMTTEWGSGNEYDSTFQHWAADLTYGGYTSKGENSEVMRFL
RNHQKDSWVGDYPQYGGAANAPLLGGYNMKDFEGWQGRNDYAAYIKNLYTHDVSTKFIQH
FKVTRWVNNPLLTADNGNAAAVSDPNTNNGNEQITLKDSNGNVVVVSRGSNDTSSAAYRQ
RTITFNGVKVASGVVSAGDGSATGDESYLLPWMWDSFTGKLVKDSEQKLYHWNTKGGTTT
WTLPDSWKNLSSVKVYQLTDQGKTNEQTVAVSGGKVTLTADAETPYVVYKGEAKQIQVNW
SEGMHVVDAGFNGGSNTLTDNWTVSGSGKAEVEGDNNAMLRLTGKVDVSQRLTDLKAGQK
YALYVGVDNRSTGDASVTVTSGGKVLATNSTGKSIAKNYIKAYGHNTNSNTENGSSYFQN
MYVFFTAPENGDATVTLSHKSTDGAHTYFDDVRIVENQYSGITYEKDGTLKSLTNGFENN
AQGIWPFVVSGSEGVEDNRIHLSELHAPFTRAGWDVKKMDDVLDGTWSVKVNGLTQKGTL
VYQTIPQNVKFEAGAKYKVSFDYQSGSDDIYAIAVGQGEYSAGSVKLTNLKKALGETGKA
EFELTGGVNGDSWFGIYSTATAPDLQGSTGNAQDFGGYKDFVLDNLKIERIESQTRTKAE
AQDKVKEIRGKYDSKRAELSDAAWQQYQDTLVKARVLINKNGATAEDFTKAYDILVALDE
YMKTAPGNESSDKYDVAADGSDELGGYTVATGSEEPTAGLPSEGPADLAQDGNDSTHWHT
SWSENAVGNGTAWYQFNLNEPTTINGLRYLPRSGGMNANGKIKGYKITLTLADGTTKDVV
TDAEFSTTTMWQKASFDAVENVTAVRLTVLSSAGQSDSQANKFASAAELRLTTDRE