Sequence (fasta): 2ziyDownload

>2ZIYA:Rhodopsin
GRDLRDNETWWYNPSIIVHPHWREFDQVPDAVYYSLGIFIGICGIIGCGGNGIVIYLFTK
TKSLQTPANMFIINLAFSDFTFSLVNGFPLMTISCFLKKWIFGFAACKVYGFIGGIFGFM
SIMTMAMISIDRYNVIGRPMAASKKMSHRRAFIMIIFVWLWSVLWAIGPIFGWGAYTLEG
VLCNCSFDYISRDSTTRSNILCMFILGFFGPILIIFFCYFNIVMSVSNHEKEMAAMAKRL
NAKELRKAQAGANAEMRLAKISIVIVSQFLLSWSPYAVVALLAQFGPLEWVTPYAAQLPV
MFAKASAIHNPMIYSVSHPKFREAISQTFPWVLTCCQFDDKETEDDKDAETEIPAGESSD
AAPSADAAQMKE