Sequence (fasta): 2x9cDownload

>2X9CA:PROTEIN PRGI
GSHMATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLY
RNAQSNTAKAFKDIDAAIIQNFR
>2X9CB:PROTEIN PRGI
GSHMATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLY
RNAQSNTAKAFKDIDAAIIQNFR