Sequence (fasta): 2x2vDownload

>2X2VA:ATP SYNTHASE SUBUNIT C
MAFLGAAIAAGLAAVAGAIAVAIIVKATIEGTTRQPELRGTLQTLMFIGVPLAEAVPIIA
IVISLLILF
>2X2VB:ATP SYNTHASE SUBUNIT C
MAFLGAAIAAGLAAVAGAIAVAIIVKATIEGTTRQPELRGTLQTLMFIGVPLAEAVPIIA
IVISLLILF
>2X2VC:ATP SYNTHASE SUBUNIT C
MAFLGAAIAAGLAAVAGAIAVAIIVKATIEGTTRQPELRGTLQTLMFIGVPLAEAVPIIA
IVISLLILF
>2X2VD:ATP SYNTHASE SUBUNIT C
MAFLGAAIAAGLAAVAGAIAVAIIVKATIEGTTRQPELRGTLQTLMFIGVPLAEAVPIIA
IVISLLILF
>2X2VE:ATP SYNTHASE SUBUNIT C
MAFLGAAIAAGLAAVAGAIAVAIIVKATIEGTTRQPELRGTLQTLMFIGVPLAEAVPIIA
IVISLLILF
>2X2VF:ATP SYNTHASE SUBUNIT C
MAFLGAAIAAGLAAVAGAIAVAIIVKATIEGTTRQPELRGTLQTLMFIGVPLAEAVPIIA
IVISLLILF
>2X2VG:ATP SYNTHASE SUBUNIT C
MAFLGAAIAAGLAAVAGAIAVAIIVKATIEGTTRQPELRGTLQTLMFIGVPLAEAVPIIA
IVISLLILF
>2X2VH:ATP SYNTHASE SUBUNIT C
MAFLGAAIAAGLAAVAGAIAVAIIVKATIEGTTRQPELRGTLQTLMFIGVPLAEAVPIIA
IVISLLILF
>2X2VI:ATP SYNTHASE SUBUNIT C
MAFLGAAIAAGLAAVAGAIAVAIIVKATIEGTTRQPELRGTLQTLMFIGVPLAEAVPIIA
IVISLLILF
>2X2VJ:ATP SYNTHASE SUBUNIT C
MAFLGAAIAAGLAAVAGAIAVAIIVKATIEGTTRQPELRGTLQTLMFIGVPLAEAVPIIA
IVISLLILF
>2X2VK:ATP SYNTHASE SUBUNIT C
MAFLGAAIAAGLAAVAGAIAVAIIVKATIEGTTRQPELRGTLQTLMFIGVPLAEAVPIIA
IVISLLILF
>2X2VL:ATP SYNTHASE SUBUNIT C
MAFLGAAIAAGLAAVAGAIAVAIIVKATIEGTTRQPELRGTLQTLMFIGVPLAEAVPIIA
IVISLLILF
>2X2VM:ATP SYNTHASE SUBUNIT C
MAFLGAAIAAGLAAVAGAIAVAIIVKATIEGTTRQPELRGTLQTLMFIGVPLAEAVPIIA
IVISLLILF