Sequence (fasta): 2warDownload

>2WARA:LYSOZYME C
KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFQSNFNTQATNRNTDGSTDYGILQINS
RWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDV
QAWIRGCRL