Sequence (fasta): 2v7aDownload

>2V7AA:PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
GPSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKE
AAVMKEIKHPNLVQLLGVCTREPPFYIIIEFMTYGNLLDYLRECNRQEVNAVVLLYMATQ
ISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWT
APESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPE
KVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGK
>2V7AB:PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
GPSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKE
AAVMKEIKHPNLVQLLGVCTREPPFYIIIEFMTYGNLLDYLRECNRQEVNAVVLLYMATQ
ISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWT
APESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPE
KVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGK