Sequence (fasta): 2v6jDownload

>2V6JA:RNA HELICASE
KRELTVLDLHPGAGKTRRVLPQLVREAVKKRLRTVILAPTRVVASETYEALRGEPIRYMT
PAVQSERTGNEIVDFMCHSTFTMKLLQGVRVPNYNLYIMDEAHFLDPASVAARGYIETRV
SMGDAGAIFMTATPPGTTEAFPPSNSPIIDEETRIPDKAWNSGYEWITEFDGRTVWFVHS
IKQGAEIGTCLQKAGKKVLYLNRKTFESEYPKCKSEKWDFVITTDISEMGANFKADRVID
PRKTIKPILLDGRVSMQGPIAITPASAAQRRGRIGRNPEKLGDIYAYSGNVSSDNEGHVS
WTEARMLLDNVHVQGGVVAQLYTPEREKTEAYEGEFKLKTNQRKVFSELIRTGDLPVWLA
FQVASANVEYHDRKWCFDGPNEHLLLENNQEIEVWTRQGQRRVLKPRWLDGRITSDHLNL
KSFKEFASGKR