Sequence (fasta): 2v1aDownload

>2V1AA:NPH1-1
FLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRAT
VRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRD
AAEREGVMLIKKTAENIDEAAKEL