Sequence (fasta): 2pgiDownload

>2PGIA:PHOSPHOGLUCOSE ISOMERASE
MAISFDYSNALPFMQENELDYLSEFVKAAHHMLHERKGPGSDFLGWVDWPIRYDKNEFSR
IKQAAERIRNHSDALVVIGIGGSYLGARAAIEALSHTFHNQMNDTTQIYFAGQNISSTYI
SHLLDVLEGKDLSINVISKSGTTTEPAIAFRIFRDYMEKKYGKEEARKRIYVTTDRTKGA
LKKLADQEGYETFVIPDNIGGRYSVLTAVGLLPIAVAGLNIDRMMEGAASAYHKYNNPDL
LTNESYQYAAVRNILYRKGKAIELLVNYEPSLHYVSEWWKQLFGESEGKDQKGLFPASVD
FTTDLHSMGQYVQEGRRNLIETVLHVKKPQIELTIQEDPENIDGLNFLAGKTLDEVNKKA
FQGTLLAHVDGGVPNLIVELDEMNEYTFGEMVYFFEKACGISGHLLGVNPFDQPGVEAYK
KNMFALLGKPGFEDEKAALMKRLSK