Sequence (fasta): 2orlDownload

>2ORLA:Cytochrome c iso-1
TEFKAGSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKK
NVLWDENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKATE