Sequence (fasta): 2ofsDownload

>2OFSA:CD59 glycoprotein
FLQCYNCPNPTADCKTAVQCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENEL
TYYCCKKDLCNFNEQ