Sequence (fasta): 2n5hDownload

>2N5HA:Peptidyl carrier protein PltL
MDGEEVKEKIRRYIMEDLIGPSAKEDELDDQTPLLEWGILNSMNIVKLMVYIRDEMGVSI
PSTHITGKYFKDLNAISRTVEQLKAESALE