Sequence (fasta): 2n59Download

>2N59A:Putative uncharacterized protein CsgH
MVQCEVEAAVSGGHVTLQGVITAVRDGAGSYKLAVDKAGAAGTSRIKQAGAFTAIAEQRV
TVGNVVLDYSSANRYAARLDVSFGSVTIQCNLDPETVKLEHHHHHH