Sequence (fasta): 2mgjDownload

>2MGJA:MYOGLOBIN
MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE
DLKKVGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH
PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG