Sequence (fasta): 2ki0Download

>2KI0A:DS119
GSGQVRTIWVGGTPEELKKLKEEAKKANIRVTFWGD