Sequence (fasta): 2k9rDownload

>2K9RA:Insulin
GIVEQCCTSICSLYQLENYCN
>2K9RB:Insulin
FVNQHLCGSDLVEALYLVCGERGAFYTKPT