Sequence (fasta): 2k9rDownload

>2K9RA:Insulin
GIVEQCCTSICSLYQLENYCN
>2K9RB:Insulin
FVNQHLCGSDLVEALYLVCGERGAFYTKPT
167327
PDB entries from 2020-08-05