Sequence (fasta): 2jmnDownload

>2JMNA:Insulin A chain
GIVEQCCTSICSLYQLENYCN
>2JMNB:Insulin B chain
FVNQHLCGSDLVEALYLVCGERGFFYTKPT