Sequence (fasta): 2jelDownload

>2JELL:JEL42 FAB FRAGMENT
DVLMTQTPLSLPVSLGDQASISCRSSQSIVHGNGNTYLEWYLQKPGQSPKLLIYKISNRF
SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPYTFGGGTKLEIKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIGDGARQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSDSPIVKSFNRN
>2JELH:JEL42 FAB FRAGMENT
QVQLAQSGPELVRPGVSVKISCKGSGYTFTTYAMHWVKQSHAKSLEWIGLISTYSGYTNY
NQKFKGKATMTVDKSSSTAYMELARLTSEDSAIYYCARVMGEQYFDVWGAGTTVIVSSAA
TTPPSVYPLAPGSGGQGNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLAADLY
TLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIAPG
>2JELP:HISTIDINE-CONTAINING PROTEIN
MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTV
VTISAEGEDEQKAVEHLVKLMAELE