Sequence (fasta): 2ipjDownload

>2IPJA:Aldo-keto reductase family 1 member C2
SKYQCVKLNDGHFMPVLGFGTAAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVG
LAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSV
KPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGL
KYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLC
ALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRN
VRYLTLDIFAGPPNYPFSDEY
>2IPJB:Aldo-keto reductase family 1 member C2
SKYQCVKLNDGHFMPVLGFGTAAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVG
LAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSV
KPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGL
KYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLC
ALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRN
VRYLTLDIFAGPPNYPFSDEY