Sequence (fasta): 2htwDownload

>2HTWA:Neuraminidase
VIHYSSGKDLCPVKGWAPLSKDNGIRIGSRGEVFVIREPFISCSINECRTFFLTQGALLN
DKHSNGTVKDRSPFRTLMSCPIGVAPSPSNSRFESVAWSATACSDGPGWLTIGITGPDAT
AVAVLKYNGIITDTLKSWKGNIMRTQESECVCQDEFCYTLITDGPSDAQAFYKILKIKKG
KIVSVKDVDAPGFHFEECSCYPSGENVECVCRDNWRGSNRPWIRFNSDLDYQIGYVCSGV
FGDNPRPMDSTGSCNSPINNGKGRYGVKGFSFRYGDGVWIGRTKSLESRSGFEMVWDANG
WVSTDKDSNGVQDIIDNDNWSGYSGSFSIRGETTGRNCTVPCFWVEMIRGQPKEKTIWTS
GSSIAFCGVNSDTTGWSWPDGALLPFDIDK