Sequence (fasta): 2hl2Download

>2HL2A:Threonyl-tRNA synthetase
MRVLLIHSDYIEYEVKDKALKNPEPISEDMKRGRMEEVLVAFISVEKVDEKNPEEVSLKA
IEEISKVAEQVKAENVFVYPFAHLSSELAKPSVAMDILNRVYQGLKERGFNVGKAPFGYY
KAFKISCKGHPLAELSRTIVPEE
>2HL2B:Threonyl-tRNA synthetase
MRVLLIHSDYIEYEVKDKALKNPEPISEDMKRGRMEEVLVAFISVEKVDEKNPEEVSLKA
IEEISKVAEQVKAENVFVYPFAHLSSELAKPSVAMDILNRVYQGLKERGFNVGKAPFGYY
KAFKISCKGHPLAELSRTIVPEE