Sequence (fasta): 2h1xDownload

>2H1XA:5-hydroxyisourate Hydrolase (formerly known as TRP, Transthyretin Related Protein)
MAATLLSPLSTHVLNIAQGVPGANMTIVLHRLDPVSSAWNILTTGITNDDGRCPGLITKE
NFIAGVYKMRFETGKYWDALGETCFYPYVEIVFTITNTSQHYHVPLLLSRFSYSTYRGS
>2H1XB:5-hydroxyisourate Hydrolase (formerly known as TRP, Transthyretin Related Protein)
MAATLLSPLSTHVLNIAQGVPGANMTIVLHRLDPVSSAWNILTTGITNDDGRCPGLITKE
NFIAGVYKMRFETGKYWDALGETCFYPYVEIVFTITNTSQHYHVPLLLSRFSYSTYRGS
>2H1XC:5-hydroxyisourate Hydrolase (formerly known as TRP, Transthyretin Related Protein)
MAATLLSPLSTHVLNIAQGVPGANMTIVLHRLDPVSSAWNILTTGITNDDGRCPGLITKE
NFIAGVYKMRFETGKYWDALGETCFYPYVEIVFTITNTSQHYHVPLLLSRFSYSTYRGS
>2H1XD:5-hydroxyisourate Hydrolase (formerly known as TRP, Transthyretin Related Protein)
MAATLLSPLSTHVLNIAQGVPGANMTIVLHRLDPVSSAWNILTTGITNDDGRCPGLITKE
NFIAGVYKMRFETGKYWDALGETCFYPYVEIVFTITNTSQHYHVPLLLSRFSYSTYRGS