Sequence (fasta): 2gmhDownload

>2GMHA:Electron transfer flavoprotein-ubiquinone oxidoreductase
SSTCKVPRITTHYTIYPRDQDKRWEGVNMERFAEEADVVIVGAGPAGLSAATRLKQLAAQ
HEKDLRVCLVEKAAHIGAHTLSGACLDPRAFEELFPDWKEKGAPLNTPVTEDRFGILTEK
YRIPVPILPGLPMNNHGNYVVRLGHLVSWMGEQAEALGVEVYPGYAAAEILFHEDGSVKG
IATNDVGIQKDGAPKTTFERGLELHAKVTIFAEGCHGHLAKQLYKKFDLRANCEPQTYGI
GLKELWVIDEKKWKPGRVDHTVGWPLDRHTYGGSFLYHLNEGEPLLALGFVVGLDYQNPY
LSPFREFQRWKHHPSIKPTLEGGKRIAYGARALNEGGFQSIPKLTFPGGLLIGCSPGFMN
VPKIKGTHTAMKSGTLAAESIFNQLTSENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRN
IRPSCHGILGVYGGMIYTGIFYWIFRGMEPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQ
ISFDLLSSVALSGTNHEHDQPAHLTLKDDSVPVNRNLSIYDGPEQRFCPAGVYEFVPLEQ
GDGFRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM
>2GMHB:Electron transfer flavoprotein-ubiquinone oxidoreductase
SSTCKVPRITTHYTIYPRDQDKRWEGVNMERFAEEADVVIVGAGPAGLSAATRLKQLAAQ
HEKDLRVCLVEKAAHIGAHTLSGACLDPRAFEELFPDWKEKGAPLNTPVTEDRFGILTEK
YRIPVPILPGLPMNNHGNYVVRLGHLVSWMGEQAEALGVEVYPGYAAAEILFHEDGSVKG
IATNDVGIQKDGAPKTTFERGLELHAKVTIFAEGCHGHLAKQLYKKFDLRANCEPQTYGI
GLKELWVIDEKKWKPGRVDHTVGWPLDRHTYGGSFLYHLNEGEPLLALGFVVGLDYQNPY
LSPFREFQRWKHHPSIKPTLEGGKRIAYGARALNEGGFQSIPKLTFPGGLLIGCSPGFMN
VPKIKGTHTAMKSGTLAAESIFNQLTSENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRN
IRPSCHGILGVYGGMIYTGIFYWIFRGMEPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQ
ISFDLLSSVALSGTNHEHDQPAHLTLKDDSVPVNRNLSIYDGPEQRFCPAGVYEFVPLEQ
GDGFRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM
PDBj@FacebookPDBj@TwitterwwPDBwwPDB Foundation

Copyright © 2013-2019 Protein Data Bank Japan