Sequence (fasta): 2ep8Download

>2EP8A:Pescadillo homolog 1
GSSGSSGKHKKLFEGLKFFLNREVPREALAFIIRSFGGEVSWDKSLCIGATYDVTDSRIT
HQIVDRPGQQTSVIGRCYVQPQWVFDSVNARLLLPVAEYF