Sequence (fasta): 2dctDownload

>2DCTA:hypothetical protein TTHA0104
MEIKDLKRLARYNPEKMAKIPVFQSERMLYDLYALLPGQAQKVHVHEGSDKVYYALEGEV
VVRVGEEEALLAPGMAAFAPAGAPHGVRNESASPALLLVVTAPRP
>2DCTB:hypothetical protein TTHA0104
MEIKDLKRLARYNPEKMAKIPVFQSERMLYDLYALLPGQAQKVHVHEGSDKVYYALEGEV
VVRVGEEEALLAPGMAAFAPAGAPHGVRNESASPALLLVVTAPRP