Sequence (fasta): 2cg4Download

>2CG4A:REGULATORY PROTEIN ASNC
MENYLIDNLDRGILEALMGNARTAYAELAKQFGVSPETIHVRVEKMKQAGIITGARIDVS
PKQLGYDVGCFIGIILKSAKDYPSALAKLESLDEVTEAYYTTGHYSIFIKVMCRSIDALQ
HVLINKIQTIDEIQSTETLIVLQNPIMRTIKP
>2CG4B:REGULATORY PROTEIN ASNC
MENYLIDNLDRGILEALMGNARTAYAELAKQFGVSPETIHVRVEKMKQAGIITGARIDVS
PKQLGYDVGCFIGIILKSAKDYPSALAKLESLDEVTEAYYTTGHYSIFIKVMCRSIDALQ
HVLINKIQTIDEIQSTETLIVLQNPIMRTIKP