Sequence (fasta): 2c0xDownload

>2C0XA:COAT PROTEIN B
AEGDDPAKAAFDSLQASATEMIGYAWAMVVVIVGATIGIKLFKKFTSKAS