Sequence (fasta): 2bugDownload

>2BUGA:SERINE/THREONINE PROTEIN PHOSPHATASE 5
MSGHHHHHHTDPPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGN
RSLAYLRTECYGYALNDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKP
HDKDAKMKYQECNKIVKQKA
>2BUGB:HSP90
XMEEVD