Sequence (fasta): 2ahqDownload

>2AHQA:RNA polymerase sigma factor RpoN
TYSLRTFFVRESAEGLTQGELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVA
KYREMLGIPSSRERRI