Sequence (fasta): 1ysbDownload

>1YSBA:Cytosine deaminase
GSSMVTGGMASKWDQKGMDIAYEEALLGYKEGGVPIGGCLINNKDGSVLGRGHNMRFQKG
SATLHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAIIMYGIPRCVIGENVNFKSK
GEKYLQTRGHEVVVVDDERCKKLMKQFIDERPQDWFEDIGE
>1YSBB:Cytosine deaminase
GSSMVTGGMASKWDQKGMDIAYEEALLGYKEGGVPIGGCLINNKDGSVLGRGHNMRFQKG
SATLHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAIIMYGIPRCVIGENVNFKSK
GEKYLQTRGHEVVVVDDERCKKLMKQFIDERPQDWFEDIGE