Sequence (fasta): 1yf2Download

>1YF2A:Type I restriction-modification enzyme, S subunit
MFYKEENFKKTEIGEIPEDWEIVELKDVCKKIKAGGTPKTSVEEYYKNGTIPFVKIEDIT
NSNKYLTNTKIKITEEGLNNSNAWIVPKNSVLFAMYGSIGETAINKIEVATNQAILGIIP
KDNILESEFLYYILAKNKNYYSKLGMQTTQKNLNAQIVKSFKIPLPPLEEQKQIAKILTK
IDEGIEIIEKSINKLERIKKGLMHKLLTKGIGHSRFKKSEIGEIPEDWEVFEIKDIFEVK
TGTTPSTKKSEYWENGEINWITPLDLSRLNEKIYIGSSERKVTKIALEKCNLNLIPKGSI
IISTRAPVGYVAVLTVESTFNQGCKGLFQKNNDSVNTEFYAYYLKFKKNLLENLSGGSTF
KELSKSMLENFKIPLPPLEEQKQIAKILSSVDKSIELKKQKKEKLQRMKKKIMELLLTGK
VRVKT
>1YF2B:Type I restriction-modification enzyme, S subunit
MFYKEENFKKTEIGEIPEDWEIVELKDVCKKIKAGGTPKTSVEEYYKNGTIPFVKIEDIT
NSNKYLTNTKIKITEEGLNNSNAWIVPKNSVLFAMYGSIGETAINKIEVATNQAILGIIP
KDNILESEFLYYILAKNKNYYSKLGMQTTQKNLNAQIVKSFKIPLPPLEEQKQIAKILTK
IDEGIEIIEKSINKLERIKKGLMHKLLTKGIGHSRFKKSEIGEIPEDWEVFEIKDIFEVK
TGTTPSTKKSEYWENGEINWITPLDLSRLNEKIYIGSSERKVTKIALEKCNLNLIPKGSI
IISTRAPVGYVAVLTVESTFNQGCKGLFQKNNDSVNTEFYAYYLKFKKNLLENLSGGSTF
KELSKSMLENFKIPLPPLEEQKQIAKILSSVDKSIELKKQKKEKLQRMKKKIMELLLTGK
VRVKT