Sequence (fasta): 1xccDownload

>1XCCA:1-Cys peroxiredoxin
MGYHLGATFPNFTAKASGIDGDFELYKYIENSWAILFSHPNDFTPVCTTELAELGKMHED
FLKLNCKLIGFSCNSKESHDKWIEDIKYYGKLNKWEIPIVCDESRELANKLKIMDEQEKD
ITGLPLTCRCLFFISPEKKIKATVLYPATTGRNAHEILRVLKSLQLTYTTPVATPVNWNE
GDKCCVIPTLQDDEISKHFKNEITKVEMPSKKKYLRFVNL
>1XCCB:1-Cys peroxiredoxin
MGYHLGATFPNFTAKASGIDGDFELYKYIENSWAILFSHPNDFTPVCTTELAELGKMHED
FLKLNCKLIGFSCNSKESHDKWIEDIKYYGKLNKWEIPIVCDESRELANKLKIMDEQEKD
ITGLPLTCRCLFFISPEKKIKATVLYPATTGRNAHEILRVLKSLQLTYTTPVATPVNWNE
GDKCCVIPTLQDDEISKHFKNEITKVEMPSKKKYLRFVNL
>1XCCC:1-Cys peroxiredoxin
MGYHLGATFPNFTAKASGIDGDFELYKYIENSWAILFSHPNDFTPVCTTELAELGKMHED
FLKLNCKLIGFSCNSKESHDKWIEDIKYYGKLNKWEIPIVCDESRELANKLKIMDEQEKD
ITGLPLTCRCLFFISPEKKIKATVLYPATTGRNAHEILRVLKSLQLTYTTPVATPVNWNE
GDKCCVIPTLQDDEISKHFKNEITKVEMPSKKKYLRFVNL
>1XCCD:1-Cys peroxiredoxin
MGYHLGATFPNFTAKASGIDGDFELYKYIENSWAILFSHPNDFTPVCTTELAELGKMHED
FLKLNCKLIGFSCNSKESHDKWIEDIKYYGKLNKWEIPIVCDESRELANKLKIMDEQEKD
ITGLPLTCRCLFFISPEKKIKATVLYPATTGRNAHEILRVLKSLQLTYTTPVATPVNWNE
GDKCCVIPTLQDDEISKHFKNEITKVEMPSKKKYLRFVNL