Sequence (fasta): 1um1Download

>1UM1A:KIAA1849 protein
GSSGSSGYVFTVELERGPSGLGMGLIDGMHTHLGAPGLYIQTLLPGSPAAADGRLSLGDR
ILEVNGSSLLGLGYLRAVDLIRHGGKKMRFLVAKSDVETAKKIHSGPSSG