Sequence (fasta): 1uh6Download

>1UH6A:ubiquitin-like 5
MKGSSHHHHHHSSGASLVPRGSEGAATMIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAA
QTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ