Sequence (fasta): 1tigDownload

>1TIGA:TRANSLATION INITIATION FACTOR 3
KQKVINVKEVRLSPTIEEHDFNTKLRNARKFLEKGDKVKATIRFKGRAITHKEIGQRVLD
RLSEACADIAVVETAPKMDGRNMFLVLAPKNDNK