Sequence (fasta): 1t1pDownload

>1T1PA:insulin
GIVEQCCTSICSLYQLENYCN
>1T1PB:Insulin
FVNQHLCGSDLTEALYLVCGERGFFYTKPT